SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGRC-118150678 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-118150678
Domain Number 1 Region: 562-771
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-46
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 2 Region: 68-148
Classification Level Classification E-value
Superfamily F-box domain 7.72e-18
Family F-box domain 0.00097
Further Details:      
 
Domain Number 3 Region: 793-902
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-118150678
Sequence length 904
Comment $ NYSGXRC $ SQ244040 $ PDBT197595 $
Sequence
MESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLFAIFLRCTKSQLR
FVQDWFSERMQVAKVDFSTVLPRFISLYIFSFLSPKDLCAAAQVSWPWKFLTEQDCLWMP
KCVKFGWFLPYTPTDNEYGAWKRHYIACVSHLDWLTPREAAATYGTLNEPKTEDEELLER
QREKCLRKRIWEKIALRKKELFKVRPPWVSGTCCSSVLKPRCQPRLSQTVRERVGLHEAL
EKQLVLTSLETLPKRSNISGSHSYPLLSKKNWHGVHKNDDRSSYALRPHFMLISSRIPAY
EMVMESVKAGVVSVVYEHSVTLESLLYLIEKALDGQKAQSIGIFSDGDSREINLLQGYKI
GVKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQLSQLTGTFFTAP
TGIATGSYQHILSDWLGSQWGKAPSSIYFCESKLQTWSSFTDFLEETLKTVRKQLYPFFK
ELQKSISGRMIGQFMFDTMGMTNILNNQDTAQALADGLMELSKEDSERNVVEDNSWDTKS
RLSKNDLNFEALINLERILQKDSAEKRARVVRELLQSERKYVQILEIVRDVYVAPLKAAL
SSNRAILSAANIQIIFCDILQILSLNRQFLDNLRDRLQEWGPAHCVGEIVTKFGSQLNTY
TNFFNNYPVILKTIEKCREMIPAFRTFLKRHDKTIVTKMLSLPELLLYPSRRFEEYLNLL
YAVRLHTPAEHVDRGDLTTAIDQIKKYKGYIDQMKQNITMKDHLSDIQRIIWGCPTLSEV
NRYLIRVQDVAQLHCCDEEISFSLRLYEHIHDLSLFLFNDALLVSSRGTSHTPFERTSKT
TYQFIASVALHRLLIENIPDSKYVKNAFILQGPKYKWICATEIEDDKFLWLSVLRNAIKS
SMEK
Download sequence
Identical sequences Q008S8
ENSP00000356655 ENSP00000356655 ENSP00000387388 9606.ENSP00000356655 NYSGRC-118150678 NP_001071174.1.87134 NP_001071174.1.92137 NP_001181966.1.87134 NP_001181966.1.92137 gi|118150678|ref|NP_001071174.1| gi|303523305|ref|NP_001181966.1| ENSP00000356655 ENSP00000387388 ENSP00000442307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]