SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-22748703 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-22748703
Domain Number 1 Region: 42-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000228
Family PDI-like 0.0047
Further Details:      
 
Domain Number 2 Region: 138-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000443
Family PDI-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-22748703
Sequence length 273
Comment $ NYSGXRC $ SQ243842 $ PDBT196984 $
Sequence
MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAV
IGFFQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLE
DEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMH
RYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEV
SVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL
Download sequence
Identical sequences Q96DN0
NP_689534.1.87134 NP_689534.1.92137 NYSGRC-22748703 ENSP00000266397 9606.ENSP00000266397 ENSP00000266397 gi|22748703|ref|NP_689534.1| ENSP00000266397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]