SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-10021a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-10021a
Domain Number 1 Region: 910-1017
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.41e-28
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 818-903
Classification Level Classification E-value
Superfamily PKD domain 3.79e-23
Family PKD domain 0.00066
Further Details:      
 
Weak hits

Sequence:  NYSGXRC-10021a
Domain Number - Region: 234-342
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0558
Family 14-3-3 protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-10021a
Sequence length 1018
Comment $ NYSGXRC $ SQ104165 $ PDBT180913 $
Sequence
MNAKSSVNFARYGYICERYLIFSQYSIKSKNSKIMAWDTKKCKVGKSMKGYSKKMLVGVS
FASLMLGSFQGGALAEGTKGEQVSYRNVLKMEPVGVQLPVQELAHSSKVLKNKSFEKRLQ
FADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLVTIDWEQITGLFQFNKDSL
AFYQNDSRIQAIIDKLNQQGQAYTKDDSKGIETLVEVLRSGFYLGFYHTELSKLNERSYH
DKCLPALKTIANNPNFKLGTLEQNRVVSSYGKLIGNASSDVETITSAAKIFKQYNDNFST
WVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYINELSRFALIGTVTE
KNGWLINNGIYYTGRLGTFHSTGTKGLQVVTDAMKMYPYLGEQYFVAAEQIATNYGGKDA
NGNVVNLDQIREDGKKKYLPKTYTFDDGTIVLKAGDKVTEEKVKRLYWAAKEVKAQFHRT
VESDQPLEKGNADDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEGTGTFFTYERTPEE
SIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAEFFAGATRTDNVVP
RKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRYDMFDKVHDLIRKN
DVTAYDAYRSALSKDVNLNKEYQDYMQMLVDNRDKYNVPLVSDDYLATHAPKPVSDIVAE
ITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKSITQNVNDTLKRLSAKEW
TGYKTVTAYFVNYRVNASGQFEYDVVFHGINTEEGAVNKAPVAVINGPYSGNVNEAISFK
SDGSKDEDGKITSYKWEFGDGAVSNEQNPTHVYTKEGTYTARLTVTDDKGLTNTVTTNVT
VQKKEDNSVEKEPNNSFQTANTLQFNQVLRASLGNGDTSDFFEINVETAKNLQINVTKEN
NIGVNWVLYSEADLNNYITYAQQEGNKLVGSYYTYPGKYYLHVYQYGGEFGNYTVEVK
Download sequence
Identical sequences Q637U3
gi|52142005|ref|YP_084824.1| 288681.BCZK3238 NYSGXRC-10021a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]