SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-11026e from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-11026e
Domain Number 1 Region: 88-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.1e-71
Family L-arabinose binding protein-like 0.0000353
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.63e-18
Family GntR-like transcriptional regulators 0.012
Further Details:      
 
Domain Number 3 Region: 420-531
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000452
Family Tyrosine-dependent oxidoreductases 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-11026e
Sequence length 533
Comment $ NYSGXRC $ SQ149769 $ PDBT176964 $
Sequence
VRQDLLARIRRGEFPPGSLLPSESQICEQYGVSVTTARRAFLELVKEGVVRRRAGVGTMV
APRVRRARIAFASIDYTGDAWRHIPSVIGEMFAGIGEHAWRRDAVLEIVGVEDEEAEGYL
RRVAERRPVDGLLLRVANDIRGEHLDILERAGMPYVLIKRHIPGRRMNCVISDDVTGARM
ATSHLLELGHRRIGFVCGKPHLTLNRERLAGYREALEEHGVGFDEGLVRQEEHFTTEMGY
RAVRSLLEAPSRPSAVFVASDTMAIGGYEAVWDLGLRIPDDVSIVGYDDIQAASALQPPL
TTVRTSYYDFGRLAAQLLLDLIEGREVAPQRRVIHPTLVVRGSTRRLSPGRGARHRPPRE
PAPVPSPGRLSGLGLLCSGLDAALRQEVVRACAAEGALPLAGEEAPPDVWVQGLSLWQDL
GTNLRRALERGRMALRRIKEGGSLVYVASAMSPDPSLGGIEHEAVRAGLERVVRVLAGEG
AGRGVRVNALLCLADRHELQTERAAQVAGTVAFLASPAARGISGETLALDGPP
Download sequence
Identical sequences NYSGXRC-11026e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]