SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-11239g from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-11239g
Domain Number 1 Region: 63-319
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.24e-46
Family L-arabinose binding protein-like 0.00038
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000015
Family GalR/LacI-like bacterial regulator 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-11239g
Sequence length 337
Comment $ NYSGXRC $ SQ169317 $ PDBT179617 $
Sequence
MKSSSIQDVAQLAHVSISTVSRSFTRPDLVSKATRDKVMKAADELNFSISRSAAALKTGR
ALRIAVLVSGRLNLWFSSSIIEGLNEVFHDEGYDISIYQMSSTEERSEFFDMLPVRRNVD
AVIVISFDIASNEIRQLRSVDVPIIGINSSLPEERGFNAAVRIDDKQGSELAARHLMMLG
HRDIVYIRSDREVTLHFSVQGRYESFMACCQANGVEPRVLVTDAGRNRISKVVTQLLSLD
HMPTAIACQEDGIAVPLLFQLERNGFTVPNDISIIGYDDSVYARDLGLTTIRQTPVEMAR
EAARMTLALIEKQPLDEPFKTFPAQLIVRSTTARLHS
Download sequence
Identical sequences A0A076JP23 A1A3R3
2004008246 gi|119026583|ref|YP_910428.1| WP_011743862.1.23347 WP_011743862.1.36503 WP_011743862.1.54320 WP_011743862.1.64668 WP_011743862.1.68247 WP_011743862.1.74636 367928.BAD_1565 NYSGXRC-11239g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]