SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-9447b from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-9447b
Domain Number 1 Region: 122-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.59e-59
Family D-glucarate dehydratase-like 0.00015
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.31e-34
Family Enolase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-9447b
Sequence length 367
Comment $ NYSGXRC $ SQ166072 $ PDBT174725 $
Sequence
MKITRVEAVPYAIPYVKPLRFASGEVHVAEHVLVRVHTDDGIVGVAEAPPRPFTYGETQA
GIIAVIEKIFVPQLLGLTLLDREVIQERLQRTVGNPAAKSAIDIAVWDALGRTLKQPVSA
LLGGYTTGLRVCHMLGFEEPAKMVAEAERMVETYGIRTFKVKVGRRPVALDTAVVRALRE
RFGDAVELYVDGNRGWSPTESLQAMKEMADLGLTCAEELCPADDVLGRRWLVSHLDVPFI
ADESATSAAEATREVLAGAATALSIKCARTGFTQSRRVHHLAEGLGLEVVMGNQIDGQLG
TACTVAFGAAYRLTSRRAAEVSNFLDMSDDLLVEPLQIRDGEIAVGQGIGLSVEIDEDKL
SHYRIDR
Download sequence
Identical sequences A1SEX3
NYSGXRC-9447b WP_011754307.1.100580 WP_011754307.1.96005 196162.Noca_0835 gi|119715080|ref|YP_922045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]