SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-9739a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-9739a
Domain Number 1 Region: 158-380
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.79e-55
Family D-glucarate dehydratase-like 0.00022
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.49e-20
Family Enolase N-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-9739a
Sequence length 386
Comment $ NYSGXRC $ SQ229609 $ PDBT175262 $
Sequence
MRIAQVSLIPLRLELRQPLKTSQGGHAVREGFLVRVVDEEGREGLGEAMPLPAFGTESLE
DCGVTLNAWLSELKGQFLGDSVRAIEDTLSPFPPAVARGDGVRIRARQVTPAGAMPAAEH
ALELALLDLLAQRQGVPLCWLLAEEARTEVAVNALLGADTPEALAGEARQAVAEGFGTLK
LKVAGRPLDADEARVKAVRDAVGPDVKLRLDANGGWSEPDAKRALDRLGWYGLELVEQPT
PPEDLAALWRVQRRAPCTVAADESLASPDALRALLTVDPLLGGGPAVGAVVLKPMVLGGL
LPCLVVAMRAARLGMQAYVTSSIDGVVARAGAAHLAAALPSGALASGLAIGRLLAKEPED
HPYHPQQGVIRLSSTPGLGLSSQSLV
Download sequence
Identical sequences Q1D6J8
WP_011553561.1.71322 WP_011553561.1.72039 WP_011553561.1.75941 WP_011553561.1.91991 246197.MXAN_3531 gi|108761657|ref|YP_631725.1| NYSGXRC-9739a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]