SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-T667 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-T667
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.11e-57
Family PP-loop ATPase 0.0000283
Further Details:      
 
Domain Number 2 Region: 324-387
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.63e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-T667
Sequence length 414
Comment $ NYSGXRC $ SQ10165 $ PDBT199424 $
Sequence
MLEEGEHVLVAVSGGIDSMTLLYVLRKFSPLLKIKITAAHLDHRIRESSRRDREFVERIC
RQWNIPVETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLE
TVVHRLIRGTGPLGLACISPKREEFIRPFLVFKRSEIEEYARKNNVPYVVDETNYNVKYT
RNFIRHRIVPLMKELNPTVEDAVYRLVSVTHLLRNFVERTVQDFVERNVYFYKDYAVFVE
PEDLFLFLEVTRWVLKEMYGRVPEYEKLIGTLKSKRVELWSGIFVERSFGYVAVGKTVFK
KKYRVEVKGDMLEMEGFKIRVVNNRNDMKFWVRNRKEGDRIIVNGRERKLKDVFIEKKVP
TFYRDRVPLLVDEEDRVLWVPGIARSDFLPEDVVVELLEYPVGYVKGGTYFEQV
Download sequence
Identical sequences Q9WZ48 R4NYV0
282452 APC4275 NYSGXRC-T667 243274.TM0579 gi|15643345|ref|NP_228389.1| NP_228389.1.35502 WP_010865151.1.29620 WP_010865151.1.45724 WP_010865151.1.51363 WP_010865151.1.56403 WP_010865151.1.79805 gi|15643345|ref|NP_228389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]