SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SsT95 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SsT95
Domain Number 1 Region: 13-156
Classification Level Classification E-value
Superfamily Nqo5-like 4.45e-41
Family Nqo5-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SsT95
Sequence length 169
Comment $ NESG $ SQ13130 $ PDBT126178 $
Sequence
MGDEKMSEALKSLVNDLQTKFKCQAKIESDRRITVIVPDKKIIRDVASFLKDFGFDHVKA
VTGIDYPEHEKLEVVYHISSYSNLDLAKIILALRTTVSYKDPSLPSLYSIFESAWTGERE
TYEMLGIRFEGHPDLRRFFLDEDFEGVYPLRKSYKIKLEGVFVDKPTTE
Download sequence
Identical sequences A0A157SY24 Q980H4
273057.SSO0323 gi|15897263|ref|NP_341868.1| 355629 356342 SsT95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]