SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ZC412.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZC412.2
Domain Number 1 Region: 18-460
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.83e-78
Family L-arabinose binding protein-like 0.0006
Further Details:      
 
Domain Number 2 Region: 920-1111
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.14e-60
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000709
Further Details:      
 
Domain Number 3 Region: 634-883
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.51e-35
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ZC412.2
Sequence length 1170
Comment $ SECSG $ SQ50390 $ PDBT12678 $
Sequence
MCLFLLLFPYLASGQFLQTVKVGLLFSKDTASVMRAVGYRTSAAAVLVARDRIRAEHLLD
QYDFNFTVKFDECTEGLAGGKTVELINHDNVDVIIGPTCNRAGIAVASLAAYYNVPVFQW
GLTTAADIGNVSRYPTTVTLSLDTHSMALGVREVLRRFEWDEFVFIYSNDGDEEKCASMK
DDLEKMGIENSDVTLAYMVQIQTVTLDALQKALTEVSKRGRIIIACFANGRGFKKAFVAS
TVLAGMSTDEYMYMFAEPQSRGFYVDEINGGEHYSWDDTDGNFVTGLTPEQIRDAYGKVL
YICDNMGLPTTITPEFANFSSQLISRMTEQPFNCVQDCSNSTYKVPATYAGQLFDAFYAY
GVALNRSLTQDPTRANLKNGSFVLSDIGMSFQGVGGGTVTLDDTGTRIVQVYMFALNTSL
LPYLAASLVINGSEVEYTPFYKSEADLWSVRPLARPICGFSGLECPPDFVKEYLVYTIIA
AVIVVLALLAGCAGLLYTMQQKISLKMDNFKILIMVKNTNFLKVEERKYTYAYGIAMAKS
RKLKSQVFPFSITLLLNFRMKRKEMERQDLLWQVPFIELQQVQSKSKAEASMHSFASGPS
TSTKITVESRSETINFIFYYYQQDILAAMKHDLILQFDAEQKAEFRQMRNFDNDNLNKFI
GLCLDGPQLFSLWRFCSRGSLSDVISKSSMQMDSFFMFSLIRDISNGLLFIHNSFLKCHG
HLTSRCCLIDDRWQIKISGYGLKSVRTFENPKKEDLLWTPPENLRNENEERLPEGDIYSF
GIICSEILTRSSAFDLENRKEKPDVIIYQVKKGGHNPMRPSLDTGETVEINPALLHLIRD
CWTERPSERPSIEQVRGHLNGMRDGRKSNLMDHVFNMLETYASTLEEEVSDRTKELVEEK
KKSDVLLYRMLPKMVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLAGKCTPLQVVTLLN
DLYTIFDGIIEQNDVYKVETIGDGYLCVSGLPHRNGNEHIRHIARMSLGFLSSLEFFRVQ
HLPSERINLRIGINCGSVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPGKIHVTAEANQ
MLTQVVGGFRTESRGEVIIKGKGVMETYWLLGEQSRISVSAQAPREKTPEPPRRQSVRSI
SPIIEKMSEETQKGLYSAYKDFNNGNECVS
Download sequence
Identical sequences ZC412.2 ZC412.2 6239.ZC412.2 ZC412.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]