SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_01883T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_01883T0
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.99e-43
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000372
Further Details:      
 
Domain Number 2 Region: 191-336
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.05e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.0001
Further Details:      
 
Domain Number 3 Region: 377-595
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.24e-28
Family Pyruvate oxidase and decarboxylase PP module 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCBG_01883T0
Sequence length 789
Comment | HCBG_01883 | Histoplasma capsulatum G186AR 2-hydroxyacyl-CoA lyase (790 aa)
Sequence
MPSLTGAQIVARSLHGLGVNVIFGIVGIPVVEVAEEAINLGIRFIAFRNEQACSYAASVY
GYMSGKPGVCLVVGGPGVLHGIAGIGNATVNAFPLLVLAGSAESHTITKGGFQEMDAISL
LTPHTKLAIRPSSLESVNDAIRNAYRTCWYGRPGPTFIDLPADLIQGKTAAGFTLPPPKH
TFVPSPPRSSGDPAVVSKVAQLLKSARAPLVVVGKGSAYARAESSIREFVEKTGIPFLPT
PMGKGVIPDSHPLNTSSARSTALKHADVVLLFGARLNWILHFGETPRWSGSVKLIQVDIN
AQEIGHNAGVAELGIVGDINLVAQQLLSSLAGWQYKPASTTSPDSYPSLLAASATKNENI
SQKKALLPTQPKEFLTFQRAYHIIKTTLNSLSPPQEGNIVYVSEGANTMDISRSAFTLEH
PRQRLDAGTNATMGVGLGYIVAAHAAYNIPSSPGSTHVHTPKKIVALEGDSAFGFSAMEV
ETLARHRIPALIFVMNNSGIYHGDTKTEGEWKNLQNETVNEANAKNGLRSTSLLYETRYE
YLAAMCGGRGYFVRTEEELERATREGFLEDEKVTIVNVIVEPGIGQSIQFGWQAAKDKTT
EAKLTQATMGMDTPASNDDIEYEPTTTPGPPGPTPTTDTLIQMMMGYLKKQDEYLKKQDE
CLKRMNEYLNRRMRNSLQKPAENSDSLSRRDQEDMKQGKDEMELAIQATVTTPPSTEEPS
ARTTKGSSVRTISIIIRITTRATTKMTMMRSIIKNTTTTTTTTTAIKELFKHRYYYHELK
PHRCRKGEG
Download sequence
Identical sequences C0NG67
HCBG_01883T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]