SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_02974T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_02974T0
Domain Number 1 Region: 3-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.88e-110
Family TK-like PP module 0.0000000108
Further Details:      
 
Domain Number 2 Region: 341-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.12e-62
Family TK-like Pyr module 0.000000105
Further Details:      
 
Domain Number 3 Region: 538-671
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.31e-40
Family Transketolase C-terminal domain-like 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCBG_02974T0
Sequence length 685
Comment | HCBG_02974 | Histoplasma capsulatum G186AR transketolase TktA (686 aa)
Sequence
MGSYTDVDQLAINTIRVLAVDATSKANSGHPGAPMGLAPTAHVLFNKFMTFNPKNPNWVN
RDRFVLSNGHGCMLQYALLHLFGYAVSLDDLKAFRTIDSITPGHPEAHDTPGVEVTTGPL
GQGFANAVGLAIAQAHTGAVFNKPGFDLINNYTYCIFGDGCAMEGVASEAASAAGHLQLG
NLICLYDDNHISIDGDTNVAFTEDVMKRFEAYGWHTIHVEDGNHDLAGIEAAIQKAKEVK
DKPTVIKVTTTIGFGSKLQGTGGVHGNALKPDDCRGVKQLFGFDPEQSFVVPQQVYDLYR
KKATEGAAREQEWNALLQQYASKYPDEHADFVRRLSGKLAEGWEKNLPRYSPSDAAVATR
KLSETVLEKIHNVIPELLSGSADLTGSNNTRWKHAVDFQPPSTGLGDWSGRYLRYGVREH
GMAGIMNGIAAYGTLIPAGGTFLNFVSYAAGSVRLSALSQVRIIYIATHDSIGLGEDGPT
HQPIETLAHFRALPNIMVWRPADGNETSAAYYSALTSRHTPSILALTRQNLPQLESSTIE
KAIRGGYVALETPNANITLVSAGSEVSLCIDAAKYLKEKHNIVARVASIPCFEVFDVQDK
AYRLSVIPDGIPVMSVEVMSTLGWERYSHEQFGLNRFGASGPYKEVYKKFEFTPEGISKR
AVATIDFYKGASVRSPLNRAFQQII
Download sequence
Identical sequences C0NI02
HCBG_02974T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]