SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_03384T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_03384T0
Domain Number 1 Region: 195-622
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.21e-81
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.011
Further Details:      
 
Domain Number 2 Region: 664-898
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.65e-46
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.019
Further Details:      
 
Weak hits

Sequence:  HCBG_03384T0
Domain Number - Region: 75-119
Classification Level Classification E-value
Superfamily Leukocidin-like 0.00621
Family Leukocidin (pore-forming toxin) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCBG_03384T0
Sequence length 1058
Comment | HCBG_03384 | Histoplasma capsulatum G186AR 2-oxoglutarate dehydrogenase (1059 aa)
Sequence
MLRTATVKASSNAAFFRRSSCACNIRAFSVISSKPANTVSRSSSKLHLASRRPLAVVGRQ
QVWNQKRYYAVAAEESSKGVGNTANYIDEMYMAWKKDPTSVHVSWQTYFRNMEDGNMPIS
QAFQPPPTLVPIPTGGVPQHMPHAGTASVAGTEVSNHLKVQLLVRAYQARGHHKAKIDPL
GIRGEAEAFGYNKPRELELDHYGFTENDLDQEFALGPGILPRFETETRKKMTLREIIAAC
EKIYCGSYGIEYIHIPDRGPCDWIRDRVEIPTPYKYSIDEKRRILDRLIWSSSFESFLAT
KFPNDKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVVRKPNESIF
SEFSGTVEPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAI
QHYNNDEKEFNTAMGVLLHGDAAFAAQGVVYETMGFHSLPAYSTGGTIHIIVNNQIGFTT
DPRFARSTPYCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVVIDIVCYRK
QGHNETDQPSFTQPLMYKRIAEQTNQLDKYVDKLISEKTFSKADIEEHKKWVWGMLNDSF
DRSKDYQPSSKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKRIGDVLGSIPENFTV
HRNLKRILANRKKTVEEGENIDWSTAEALAFGSLCAEGHHVRISGQDVERGTFSQRHAVL
HDQENETTYTSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFA
NNAQCIIDQFIASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPA
PDRIDRQHQDCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSD
FTGDSHFQWIIADPEHGSPSLNNHKDIERVILCSGQVYAALQKHRAAHGINNTAITRIEQ
MHPFPWQQLKENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETVHHNRRHVLYA
GRNPSASVATGLKASHVKEEQDLLQDAFSVHQDRLKGE
Download sequence
Identical sequences C0NJQ4
HCBG_03384T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]