SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_05046T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_05046T0
Domain Number 1 Region: 458-812
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.96e-68
Family PFOR PP module 0.0000358
Further Details:      
 
Domain Number 2 Region: 1086-1292
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.55e-54
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000172
Further Details:      
 
Domain Number 3 Region: 785-940
Classification Level Classification E-value
Superfamily Flavoproteins 2.87e-36
Family Cytochrome p450 reductase N-terminal domain-like 0.031
Further Details:      
 
Domain Number 4 Region: 1375-1514
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.51e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000116
Further Details:      
 
Domain Number 5 Region: 952-1085
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.52e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0011
Further Details:      
 
Domain Number 6 Region: 1294-1371
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.0019
Further Details:      
 
Domain Number 7 Region: 303-440
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000942
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0034
Further Details:      
 
Domain Number 8 Region: 74-192
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000171
Family PFOR Pyr module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCBG_05046T0
Sequence length 1535
Comment | HCBG_05046 | Histoplasma capsulatum G186AR sulfite reductase beta subunit (1536 aa)
Sequence
MGSVSTAGEAVARIAYLSSDLVLSVQPSLQADSLFSKHLRKLSADNVRGVVSQGFPEIRS
LRQNEDPLLSAFQPLQSGHRVALTASSSVLLPSIPYLYKLANYPLVIHVCLDPAPFPDYS
VVSSIRQCGFSFLHSETLQEAQDIALTAHSLAAKSGKGVIHFFDATNSQQDKPIASEDPE
LVKKILDLELVQHAHVPSNAPHTLYANSGRVATIVEEDLGASEGHATGLSASQLSLPLNT
SANGHFSASSSGSDSGSDGVPASSSATTVEPLTVRPVDASDIFQITSKIWDELSQLSGRQ
YHAIEYVGPDNAQSAVFVFGSTGVLVDVLRNPSSKADFANVGVITARLYRPWIGGQISHT
IPKSIERIAVLEQVRKTTRWGPAFLDLLSSLSQPTSSGRAPQLVGYRLGYIEPSTASQTL
RDIFQNLEADSPIQNLQVGREKVPEEISITISAPGQPEAENAYMKILNQLFSARLYVANQ
LGSENAGISSTIASTPEYGFGSLIARIEGRQRFIREVAEAAKSTMFTTDTPKTWLSRWAL
NATDAVKANSLAADVISQLGVDGSPLARKLLQSKQYFSKESQWLIGSDAWAYDLGNSGVH
HVLASGADVNMLIIDSQPYSERVAADATRRKKDIGLYAMNFGNAYVASVAVYGSYTQVLQ
AMAEADQFDGPSVVLAYLPYNKESDSPLTILQETKKAVDLGYWPLYRWNPKNAERGEPNF
ALDSERIKRELEGFLRRDNQLTQLMKRHPRFSASLSESYGTEVRALQKRAAKDSYDKLLE
GLFGAPLTILFASDNGNAENLAKRLANRGKARGLKTMVLAMDDYPIEDLATEENVAFITS
TAGQGEFPQNGRALWEVIKNSGDLDLSSIHYSVFSLGDSHYWPRKEDKIYYNKPGKDLDA
RVSFLGGKKLTDIGLGDDQDPDAFQTGYQEWEPRLWRALGVDKVEGLPEEPPPLTNEDMK
LQSNYLRGTIAEGLRDESTGAISATDQQLTKFHGTYMQDDRDVRDERKAQGLEPAYSFMI
RCRLPGGVATPKQWLQMDAISSAHGNETMKLTTRQTFQFHGVVKGKLRPAMQAINQALMT
TIAACGDVNRNVMCSSLPELSYYHKEVHAISKRISDHLIPSTTAYHEIWLKDDKDTKIQV
AGNAVVDHEPLYGPTYLPRKFKITIAIPPHNDTDVYAHDIGLIAIKGANGHLEGFNVLAG
GGMGMTHNNKKTYPRTGSMFGFVPADHIHIVCEKIMLVQRDHGDRKNRKHARLKYTIDDM
GSDVFKSKVEDLLPSNLRFTPSRPFKFDSNIDTFGWQKDERGLNHFTFFIENGRVEDTAE
FSMRTGLRKLAELGKGEFRLTGNQHVILSNIEDADLPAVKALMAEYKLDNTAFSGLRLSS
SACVAFPTCGLAMAESERYLPILIDKLEDCLAENGLSKESIVMRMTGCPNGCARPWLAEV
AFVGKAYGAYNMYLGGGYHGQRLNKLYRASIMEDEILTIMKELLKRYSLERRAAAVEGGE
SERFGDWCIRSGVIKETTEGKTFHEDVAEDDEDEE
Download sequence
Identical sequences C0NPG6
HCBG_05046T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]