SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_05784T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_05784T0
Domain Number 1 Region: 64-268
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.71e-62
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000967
Further Details:      
 
Domain Number 2 Region: 253-389
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.24e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCBG_05784T0
Sequence length 390
Comment | HCBG_05784 | Histoplasma capsulatum G186AR 2-oxoisovalerate dehydrogenase (391 aa)
Sequence
MATLSRRAVRKQLLNSLCRLYSTHVPSPAAHLNLPINYGTTPLLHHSPSTISSSVELPKS
GATKRINLYQSINSALRTALSTSDQVLLFGEDVAFGGVFRCSVDLQTEFGSERVFNTPLT
EQGIVGFAIGTAAEGMKPVAEIQFADYVYPAFDQLVNEAAKFRYREGATGSHVGGLVVRM
PCGGVGHGALYHSQSPESLFTHIPGLRVVMPRSPTQAKGLLLSSILECNDPVVFMEPKIL
YRAAVEHVPTEAYTLPLDKADVIKPGKDLTVISYGQPLYLCSAAIEAAEKAFKGVSIELI
DLRTLYPWDRSTILESVRKTGRAIVVHESMLNAGIGAEVAATIQEGAFLSLEAPVKRVTG
WDIHPGLIYERFNMPDVARIFDAIKTSLEY
Download sequence
Identical sequences C0NQJ6
HCBG_05784T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]