SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_05897T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_05897T0
Domain Number 1 Region: 66-438
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.37e-103
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCBG_05897T0
Sequence length 450
Comment | HCBG_05897 | Histoplasma capsulatum G186AR 2-oxoisovalerate dehydrogenase alpha subunit (451 aa)
Sequence
MSFPLLGRSVRSASQPILRATRSANRSVRWSTSISQRPGSDSVRFPGAIDSKFTTNMSFI
NPSEHAAIPTYRVMDSDGVIVDKSRGPPDVTSEEVITWYKNMLTVSIMDLIMFDAQRQGR
LSFYMVSAGEEGIAVGSAAALTPEDIVFAQYRETGVFQQRGFTLKDFMSQLFANRNDPGK
GRNMPVHYGGSKVNTHTISSPLATQIPHAAGAAYALKLQSLQNPNIPQRIVTCYFGEGAA
SEGDFHAALNIAATRSCPVVFICRNNGYAISTPTLEQYRGDGIASRGIGYGIDTIRVDGN
DIFAVHEVTREARRMALENGGRPVLIEAMSYRVSHHSTSDDSFAYRARVEVEDWKRRDNP
ITRLRKWMEGEGIWNDDLERDTRDELRKAVLQEFSAAEKEKKPPLREMFNDVFEKLPEST
VKQKEELKRILETYPAEYDIREFEDGIKGL
Download sequence
Identical sequences C0NRW7
HCBG_05897T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]