SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_06694T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_06694T0
Domain Number 1 Region: 342-538
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.04e-44
Family Pyruvate oxidase and decarboxylase PP module 0.0000101
Further Details:      
 
Domain Number 2 Region: 150-326
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.58e-35
Family Pyruvate oxidase and decarboxylase, middle domain 0.000028
Further Details:      
 
Domain Number 3 Region: 15-163
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.27e-32
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCBG_06694T0
Sequence length 546
Comment | HCBG_06694 | Histoplasma capsulatum G186AR pyruvate decarboxylase (547 aa)
Sequence
MATEIPSKELKSPVDIAHYLFTRLYQVGIRAVHGVPGYAADGYARVNGMGALVTTFGVGE
LSALNAVAGSYSEFVPVVHIVGQPSTASQRDGMLLHHTLGNGDFNVFANMSANISCYVAK
LNDPHEAAALIDSAIRECWIRSRPVYITLPTDMTKKKVEGERLKTPIDLKRPENEVEKEE
YVVEIVLKYLHAAKSPVILVDACAIRHRVLDEVQDLVIKSGLPTFVTPMGKSAIDETLPN
YGGVYAGNGSNPGVKERVESSDLILNIGAIKSDFNTAGFTYRIGRMNSIDFHSNFVAVRY
SEYPNVHMKGVLRKVVDRMGQLNVTPGPRVINQPPKQEPSETSAISHAWFWPTVGQWLRE
KDIIITETGTANFGIWETRFPKGVTALSQVLWGSIGYALGACQGAALAAKRGNQDRRTVL
FIGDGSFQLTAQELSTMIRHNLTPIIFVICNDGYTIERCIHGWDASYNDIQPWKFGDLVP
AFGAKSSTFKTHTVKTKKELVDLFADESFSSAKSLQLVELHIPKTDTPAALRLTAEAASK
TNAEHE
Download sequence
Identical sequences C0NUT0
HCBG_06694T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]