SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_07358T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_07358T0
Domain Number 1 Region: 38-372
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.42e-50
Family TK-like PP module 0.078
Further Details:      
 
Domain Number 2 Region: 399-598
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.12e-21
Family TK-like Pyr module 0.025
Further Details:      
 
Domain Number 3 Region: 604-746
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000345
Family Transketolase C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCBG_07358T0
Sequence length 803
Comment | HCBG_07358 | Histoplasma capsulatum G186AR phosphoketolase (804 aa)
Sequence
MPGEIIDKPNPKPLPSHLPEVIDQLAVRLARTSLDQNVVDSLQRFQRAANYIAAGHWGTC
PGLTFVYSHLNYLICKHDLDMIYVVGPGHGAPGILAALWMEGSLEKFYPGYSRDTKGLTK
LITTFSTTGGFPSHINAETPGAIHEGGELGYALSVSFGAVMDKSDLIVICIIGDGEAESG
PTAASWHGFKYIDPAESGAVLPILHLNGFKISERTIFGCMDDRELIALFVGYGYQPRIID
DLEHVNVDFHGALEWALEEIRKIQQAARSGNPIMKPRWPILILRTPKVSAQMAIHYVLSM
LTYMVQGWTGPKQIHGQTIEGSFKAHQVPLPAAKKDKEELKVLSEWLMSYKPHELFTEGG
DVIDDIKAIIPRNDLKKLGQRSDVYESYRTLKLPDWKGFHIEKGKQESSMEIIAEFIDQV
FVDNPHSVRLFSPDELESNKLGGALAHTGRNFQWDQFANAQGGRVIEVLSEHMCQGFLQG
YTLTGRVGIFPSYESFLGIIHTMMVQFSKFTKMGRETVWRRDIASINYIETSTWTRQEHN
GFSHQNPSFISAVLNLKPNAARVYLPPDANTFLSTLNHCLKSKNYINLMVGSKQPTPVFL
GPDEAESHCRAGGSVWKFASTDEGKDPDVVLVGVGTELTFEVVQAAALLRERVPELRVRV
VNVTDLMILSRETSHPHALSDEAFDALFTSERPIHFNYHGYETELRGLLFGRPQMERVTI
ASYMEEGSTTTPFDMMLINRVSRFHVAQAAVCGGAIRNEDVMIRRCELLSEFDHNMNETR
KYIMQHHKGKFTPVPFLNDQALD
Download sequence
Identical sequences C0NW28
HCBG_07358T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]