SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_07872T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_07872T0
Domain Number 1 Region: 70-386
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-96
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCBG_07872T0
Sequence length 405
Comment | HCBG_07872 | Histoplasma capsulatum G186AR pyruvate dehydrogenase (406 aa)
Sequence
MLSRITPVRQVAPLCRKAFVPVLRRSVTTDAASAHAEAIPVEEDKPFTVKLSDESFETYE
LDPPPYTLETTKQELKQMYRDMVSIRRMEMAADRLYKEKKIRGFCHLSTGQEAVATGIEH
AITKDDKLITAYRCHGFALLRGGTVKSIIGELLGRREGIAYGKGGSMHMFAKNFYGGNGI
VGAQVPVGAGLAFAQQYNDEKTTTIALYGDGASNQGQVFEAFNMAKLWNLPCIFGCENNK
YGMGTAANRAAALTDYYKRGQYIPGLKINGMDVLAIKAAVQYGREYTTSGKGPLVFEYVT
YRYGGHSMSDPGTTYRTREEIQRMRSTNDPIAGLKQKLLDWGVTSEEELKAIDKDARKYV
DDEVAEAELMTEPDATPRILFEDTYVRGSEPAWTRGRTVDETFYY
Download sequence
Identical sequences C0NY78
HCBG_07872T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]