SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_08382T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_08382T0
Domain Number 1 Region: 50-231
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000199
Further Details:      
 
Domain Number 2 Region: 238-375
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCBG_08382T0
Sequence length 377
Comment | HCBG_08382 | Histoplasma capsulatum G186AR pyruvate dehydrogenase (378 aa)
Sequence
MATPRLLKPASRLVSTRLCSASIRSAFKPAACSPSVLQRRTYATPSGTKEVTVREALNDA
LAEELTLNEKVFILGEEVAQYNGAYKVTKGLLDRFGPKRVIDTPITEPGFCGLAVGAALA
GLHPVCEFMTFNFAMQAIDQIVNSAAKTHYMSGGIQPCNITFRGPNGFAAGVAAQHSQDY
SAWYGSIPGLKVLSPWSSEDAKGLLKAAIRDPNPVVFLENELMYGESFPMSEAAQKDDFV
LPIGKAKIERVGKDLTMVSLSRCVGQAMRAAAELKQKYGVETEVINLRSIKPLDVETIIK
SVKKTGHLMAVESGFPMFGVGSEILALSMEYAFDYLQAPAVRVTGAEVPTPYALKLEQMS
FPQDETIVTHAAKLLRV
Download sequence
Identical sequences C0NZ02
HCBG_08382T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]