SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_00158T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_00158T0
Domain Number 1 Region: 517-718
Classification Level Classification E-value
Superfamily Smc hinge domain 5.36e-50
Family Smc hinge domain 0.00044
Further Details:      
 
Domain Number 2 Region: 1046-1256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.57e-35
Family ABC transporter ATPase domain-like 0.00000211
Further Details:      
 
Domain Number 3 Region: 4-99,138-217,1163-1251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-31
Family ABC transporter ATPase domain-like 0.00003
Further Details:      
 
Weak hits

Sequence:  HCBG_00158T0
Domain Number - Region: 741-963
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.006
Further Details:      
 
Domain Number - Region: 413-533
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCBG_00158T0
Sequence length 1271
Comment | HCBG_00158 | Histoplasma capsulatum G186AR structural maintenance of chromosomes protein 1 (1272 aa)
Sequence
MGKLIRLELFNFKSYKGHHTLLFGDAYFASIIGPNGSGKSNSSVSPFPNAYYRMDAISFV
LGIKSSHLRSTHLRDLVYRGRVLRTSTINDDGSASNNIQNGVNGDGDVESTQEPAERNDP
RVAWVMAVYEDDAGEEQQWKRSITSQGVSEYRINNRIVTAQQYNQSLEDENILIKARNFL
VFQGDVESIASQSPRDLTRLIEQISGSLEYKAEYERLKAEQEETAEIQNAQLNRRRGINS
EIKQYQEQKREAENYARKADERDQAIITHILWKLFHFQRLIKESSAEIQKHQDELKEFRR
GVEKYGKNLEEAKKEHARVGRDVAKVEKSIKLKEKDIEDTTNSLVPVDEKIEISKQKVER
YATRISEIEKESNAQLKTVRQLEKDLKVVEKAQSQWEDDWMKTANKRGIQLSNSDLQEYN
KLREDVNKRSSAAQIKLANLKRQRKADAETVNSLKSNFESTEWQVKNLQSDVNNMLERKS
SMEDAIDATSKEISQKKKELNSLTSERLRVAQMRTELEEKLQVTLKKLLEADDGRKQSEK
ELRTKELISTLKRIFPGVKGRISELCKPKQKKYQDAVSTILGRHFDSIVVDNEKTAKECI
QHLRDQRAGQATFIPLETIQVKAFNSNLKGMHRGMRPAIETVDYDNSVSRAITYACGNAI
VCDDLATAKYLCYEKGVDAKAVTLDGTVIHKGGLMTGGRGPGHQQAKRWEDTDITNLHKL
KDKLIADLGSLPKAHRKGAEEENLQGQLAGLEQRLAYSRDELKALNRNIESRSGEVQFSK
SQMTSIQPKYFEKKRALEALDESIKDAQSSVSGVEDEVYQAFCRRLGYSNIREYEAQQGS
LQQEAAEKKLEFTTQKSKIENQLSFERQRLQATDDRIEGLRSQAERDRALITELEAERNA
IKDRLDTLNAELELLGEDLAEQKEAYSQSAEHLATQRQQVQKRSRNIETTLKAISSLDGE
RQRYASDKYALLRRCKLEDIDIPLVKGSVPLSALPIDDLVQNDEDAMDVDEDPNLGNFQA
SAIHDYGIEVEFESLGDSLKEDSDDKVEEELQDRIKSLNSELDKMAPNMRAMERLEGVEN
KLRSTEKDFEDARKRARKAKEDFEAVMRKRSELFNKAFTHISEQIEPIYRDLTKTASYPM
GGKAYLDIEDSEEPYLDGIKYHAMPPLKRFRDMEHLSGGEKTMAALALLFAVHSYQPSPF
FVLDEVDAALDNTNVARIANYIRDHAAPGMQFIVISLKTGLFQNSEALVGIYRDQTANSS
KCLTLDLRKYR
Download sequence
Identical sequences C0NAL2
HCBG_00158T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]