SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_01060T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_01060T0
Domain Number 1 Region: 486-700
Classification Level Classification E-value
Superfamily Smc hinge domain 1.57e-47
Family Smc hinge domain 0.00093
Further Details:      
 
Domain Number 2 Region: 1-234,1105-1193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.04e-41
Family ABC transporter ATPase domain-like 0.00068
Further Details:      
 
Domain Number 3 Region: 857-944,986-1210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.33e-28
Family ABC transporter ATPase domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCBG_01060T0
Sequence length 1219
Comment | HCBG_01060 | Histoplasma capsulatum G186AR chromosome segregation protein sudA (1220 aa)
Sequence
MYIKQIIIQGFKSYKDQTVIEPFSPKHNVIVGRNGSGKSNFFAAIRFVLSDAYTHMGREE
RQALLHVRKPKPIQLIVGRLSTDSIQEGSGSAVMSAYVEIIFDNSDERFPTGKKELILRR
TIGTKKDEYTLDRKNATKSDVMNLLESAGFSRSNPYYIVPQGRVTTLTNMKDSERLVLLK
EVAGTQVYEARRAESLKIMNETNNKRAKIDESLDYINERLAELEEEKDELKNYQEKDRER
RCLEYTIYSREQAEIASALENIEGQRQTGVEDTDANRNRFIQSENDIAQIDAEISELKQA
VELLKVEKTQIEEDRRDVSRVLAQAELRAKSLSEGQSAAQRAKARHDANLKTVQTAIKER
EKELSKLLPEFEAKQKQEEEVKAKLDEAETARQRLYAKQGRNSKFRNKSERDKWLQREIQ
DTYTSLSTVKAVRMQTEEEIKQLVNDIALLEPEIEKLRKQLDGRGNALQSMEQEVQGAKD
ERDRLMDQRKELWREEARLDSIISNASQELDRAERNVSHMMDHNTSRGLAAVRRIKRQLS
LEGAYGTVAELLDVNERYRTAVEVTAGQSLFHYVVDTDETATKVLEVLQKEKLGRVTFMP
LNRLKPKPANVPRASDTIPIIEKLVYDKTFEKAFQQIFGKTIICPNLQVAAQYARSHGVN
AITPEGDRSDKRGALTGGFHDSRQSRLEGLKVVTKWRDEVESKRNRGVEIRRELEKMDQL
ITRAVGELQKLEQRRQQLQSSNIPLRQEIKSKRDMHQNKMDTLEAKQRALRNMEANVKTL
SDQITAHEEELSTHFEKALTNAEEARLESLNSTVQELRSQHSELSSSRSELETSKSVIEV
ELRENLNPKLDQLIGHELETGGDSTHGNLKESQREIDRHRKFLDSLDLRLEKLEESMESG
LADLSKLEQRKADIKRELEDLARSMEKHQRRMEKSMQKKAALTKQAAECSANIRDLGVLP
DDAFTKFKNTDSNTVVKRLHKVNEALKKYSHVNKQAFEQYNGFTKQRETLTKRREELDSS
QKSIEELITVLDHRKDAAIELTFKQVSREFAQIFEKLVPAGRGRLIIQRKTDRRNQQEDE
LDSDEEEARNSVENYVGVGISVSFNSKHDDQQRIQQLSGGQKSLCALALVFAIQACDPAP
FYLFDEIDANLDAQYRTAVAQMLKSIAEETNGQFICTTFRPEMLLVAEKCYGVSFRHKAS
SIDVVSRDEALKFVEEQKS
Download sequence
Identical sequences C0ND64
HCBG_01060T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]