SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_02834T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_02834T0
Domain Number 1 Region: 1051-1086
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.000000131
Family GAS2 domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCBG_02834T0
Sequence length 1315
Comment | HCBG_02834 | Histoplasma capsulatum G186AR GAS2 domain-containing protein (1316 aa)
Sequence
MADDPFSLTPALRLRPSSNIGTPSRSSPRSPTPCRSRSPDPNATSLVCTLDPLLANLSPE
STLAALAATDAMRTNGKTAEGILAKAIAEASRDERALAVRAAVAGQNLKQWHAEVLAWEW
PRKQDAVAGKGFIPPNNGRVYIGDGDDDDGWEKYLGCLPAAIVEQHEERIDAIKAGMKAL
DVEELKEHVLNAHIPSRSRPSSSNSSWSTNTNTLSYVQLSDFTAVITANILQALPYLSKL
NILLNIWDVRITVLHQVPELLAGLGNTKRDIYGALDRLKIRLLPELDNPLFSKTSFGSAR
HRLESKVLIVGSKMDRILDSLEGQEDVLPDVWIDEMEAIETAFATWAFEAGKMASENDFK
RSIPPLPECSMQSSETEMPEKASLGNPTTQSSTSLLGNDRKDKDDNSVEVMEDRSIHIEL
ELPTTPFQTDPVPNDEISPELMDVQRTPPPSSPLIPQVQRPGKDISQAGTQSTHTAVSSE
TELTQESLNPTHSDSDTSSALPSTPTTSTTREELTSLSCPGAAEPLMNQQSIDELPEKAA
QLVEDHASDKTPGTGNSNKPSSVLIETPENSPEPPDNPAEQSLAEETIGTNQSFPRSPLP
SQNADPASPQSPEPKASPGQRRPFNNTDLSTSSSPTTAELGPYKATKNKPEALKLETIVQ
RRDSIVSSASTPGSGLSYISDPEIKDAQVATAHGSPVVVESPGGFLATASKAPWALGPGG
NMLSRTKSAESNSGAATSSRPPAQRTMSLPLERFVDGDPQAVHEMDDPNESNDKQEVRRA
SSASIEVSPKTELLSIVVSNRLSMGPTNGPKPAPNLRRSVSSLALSSINRISNISRGLHP
NYPRGLRLSTSSDSLPSTAEEQSPSVHISDSKDNIIPSPDTPTPPPILPRRSSKRFSRLL
SPVTSISSHKERNTLPTTHGATLSRDVAANSVISPSFNAPKSPEDQLEEKINSILTTIPT
RIHLVSTPDRSNGIKTTKKAPRASEPSYSTPRNDRLGSQSPMSSRSTTPTPSLTLTPAFG
RSRRPHTHHDDESAVRLYHLHRGGKAAPLKLFVRSVGEDGERVMVRVGGGWADLGEYLRE
YAVHHGRRNVSDAKFEVRGLPNNNNTSPNYTQNKHAPVPNTGRSTPVSRPGSAFDIRPSS
SLNIRKTRRSMANPAELPNLTTANIEKASGGSSDPSSNGSGGPLSFFSSSRRRLSTSSNA
SMSVASTYGGEGQQYASTPLGLAGPHPKSRQVSISPESEAWVENVVGRARRTSATLRPER
SYGNLRRFRPNALQEDALRDRTEGRGYRSVSDVGGGGGAGNKRVYLRGLDRGRVE
Download sequence
Identical sequences C0NHL2
HCBG_02834T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]