SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCBG_03941T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_03941T0
Domain Number 1 Region: 670-758
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.49e-19
Family Calcium ATPase, transduction domain A 0.0037
Further Details:      
 
Domain Number 2 Region: 862-886,921-981,1019-1091
Classification Level Classification E-value
Superfamily HAD-like 1.24e-18
Family Meta-cation ATPase, catalytic domain P 0.029
Further Details:      
 
Domain Number 3 Region: 213-284
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000000000275
Family HMA, heavy metal-associated domain 0.0017
Further Details:      
 
Domain Number 4 Region: 300-366
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000000000089
Family HMA, heavy metal-associated domain 0.0021
Further Details:      
 
Domain Number 5 Region: 590-650,759-858
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000981
Family Calcium ATPase, transmembrane domain M 0.01
Further Details:      
 
Domain Number 6 Region: 25-97
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000236
Family HMA, heavy metal-associated domain 0.0061
Further Details:      
 
Domain Number 7 Region: 386-453
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00000628
Family HMA, heavy metal-associated domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCBG_03941T0
Sequence length 1237
Comment | HCBG_03941 | Histoplasma capsulatum G186AR copper-sulfate regulated protein (1238 aa)
Sequence
MADNQPIPKPAAVAKRTSLPLLSAGPKTTTTVLLVNNIHCASCVAYAKEVLFHIPHIISV
DVTILAHKVHIRHGPEVSTTHLVNALINAAFEVYHASSRDESGAEISNIDVSLPASPFIE
RHLFRTGVQGDKNAQARNRTHIDNCDACRAEELARTQADEKKDLSSFPQLHAVGDKTPMG
NDLSKKPEKVADESWMIKRSDVPDLEKGLALTDEEYNVSISISGMSCSSCAGTVTSAVEQ
LSFVKSVDVAFLTHSASLTIRGPKENIDEVLSVIDGLGYEGELQDISLKSSPSSRRDIYA
ATASIGGMTCGSCVGTITRGIQELPFVTNVVVDLLGSSAKFEFEGRERLDEIKQVVEGLG
YEFVVTQCVPLKQNGTGPDDNSPLKRTVEIKVDGMFCHHCPEKILSALEAMDSESVSVVE
SLTFKKNVVKITYQPNPPSMTIRKIIAVIESANDAFKASIYHPPTIEDRSRAMQLLERRR
ILLRLLFVFIAAIPTFLIGVVWMSLVPSTNRLRTYFYEPIWAGQVTRLEWALFIITTPVM
CYGADVFHVRAFKEIRALWRPRSKVPILRRFYRFGSMNLLISAGTSVAYFASIAMLAVAA
GMEEHQPHMSPYFDTVVFLTLFILAGRFLEAYSKAKAGDAVASLGKLRPSEALLVLDSPS
TNPDDAPSSNLQRVNVDLLEVGDIVNIPHGASPPADGIVTSSDTYRFDESSLTGESKPIT
KVAGDKVYSGSVNVGQPVYIRVSDIGSTSMLDQIVAVVREGLTKRAPVEGVADIMTSYFV
PVITLIAILTFVIWLSLGLSGSLPPDYLDSAQGGWAFWSLKFAIAVFVVACPCGLALAAP
TALFVGGGLAARRGILVRGGGEAFQEASKLEAIVFDKTGTLTEGGTLRVSDHEMLVADEE
QQRVAWELARTLEQSSTHPIANAIADFCAEQSSVSVISSTLTEIPGQGMKGMFSLTVNGV
EVKYEAAIGSQRLLDSLVDENGTDLYFLSNTLTKYQSEAKSTAILAIRQISDAPSPFVPA
IVFATSDPIRPEAASVISSLQSKNIEVFMCSGDNQTTAHAVAATIGIPASNVLANVLPSQ
KAEYVRQIQDNKLHTTTSTSSSRQETHHRLRRRRHQRLPRPHRRKREYCHGLRLPWPPAP
TSPRVFNRVKWNFGWAAIYNMILVPVAAGVLFPIVTGKKVKEHGTVVNEHWRLDPVWASL
AMALSSISVVVSSLALRFEWRRARPWIVRKVRFWTKA
Download sequence
Identical sequences C0NLB1
HCBG_03941T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]