SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HCDG_03632T0 from Histoplasma capsulatum H143

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCDG_03632T0
Domain Number 1 Region: 61-370
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.4e-57
Family TK-like PP module 0.039
Further Details:      
 
Domain Number 2 Region: 397-596
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-21
Family TK-like Pyr module 0.024
Further Details:      
 
Domain Number 3 Region: 602-744
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000242
Family Transketolase C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCDG_03632T0
Sequence length 801
Comment | HCDG_03632 | Histoplasma capsulatum H143 phosphoketolase (802 aa)
Sequence
MPGEIIDKPNPKPLPSHLPEVIDQLAVQLARTSLDQNVVDSLQRFQPMIFLQDNACLKRE
LKFDDIKPRLLGHWGTCPGLTFVYSHLNYLICKHDLDMIYVVGPGHGAPGILAALWMEGS
LEKFYPGYSRDTKGLTKLITTFSTTGGFPSHINAETPGAIHEGGELGYALSVSFGAVMDK
SDLIVTCIIGDGEAESGPTAASWHGFKYIDPAESGAVLPILHLNGFKISERTIFGCMDDR
ELIALFVGYGYQPRIIDDLEHVNVDFHGALEWALEEIRKIQQAARSGNPIMKPRWPILIL
RTPKGWTGPKQIHGQTIEGSFKAHQVPLPAAKKDKEELKVLSEWLMSYKPHELFTEGGDV
IDDIKAIIPRNDLKKLGQRSDVYESYRTLKLPDWKGFHIEKGKQESSMEIIAEFIDQVFV
DNPHSVRLFSPDELESNKLGGALAHTGRNFQWDQFANAQGGRVIEVLSEHMCQGFLQGYT
LTGRVGIFPSYESFLGIIHTMMVQFSKFAKMGRETVWRRDIASINYIETSTWTRQEHNGF
SHQNPSFISAVLNLKPNAARVYLPPDANTFLSTLNHCLKSKNCINLMVGSKQPTPVFLGP
DEAESHCRAGGSVWKFASTDEGKDPDVVLVGVGTELTFEVVRAAALLRERVPELRVRVVN
VTDLMILSRETSHPHALSDEAFDDFFTSERPIHFNYHGYETELRGLLFGRPQMERVTIAS
YMEEGSTTTPFDMMLINRVSRFHVAQAAVCGGAIRNEDVMIRRCELLSEFDHNMNETRKY
IMQHHKGKFTPAPFLNDQALD
Download sequence
Identical sequences C6HC83
HCDG_03632T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]