SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28572280|ref|NP_789060.1| from Tropheryma whipplei TW08/27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28572280|ref|NP_789060.1|
Domain Number 1 Region: 58-153
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 5.62e-24
Family Ribosomal protein L9 C-domain 0.00051
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 4.53e-16
Family Ribosomal protein L9 N-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28572280|ref|NP_789060.1|
Sequence length 153
Comment 50S ribosomal protein L9 [Tropheryma whipplei TW08/27]
Sequence
MTRVILVQDVNGLGSVGDVVEVKAGYSRNYLVPKGMAVRWTEGAQKHIGDISAARRAREA
AALQEARDIANTLTKEAVTRELRLAANAGEDGRLFGSVTAANIAKVLSSASGHKIDRGKI
EIDSPIKTLGEHTVKVKLHPNVKVDINVVVYAE
Download sequence
Identical sequences Q83IC2
WP_011096078.1.1961 WP_011096078.1.30872 WP_011096078.1.3524 WP_011096078.1.35576 WP_011096078.1.41189 WP_011096078.1.42537 WP_011096078.1.52318 WP_011096078.1.64596 WP_011096078.1.68459 WP_011096078.1.69741 WP_011096078.1.7325 WP_011096078.1.77801 WP_011096078.1.80906 WP_011096078.1.86550 WP_011096078.1.87151 WP_011096078.1.88484 WP_011096078.1.91097 218496.TW114 gi|28572280|ref|NP_789060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]