SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28572497|ref|NP_789277.1| from Tropheryma whipplei TW08/27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28572497|ref|NP_789277.1|
Domain Number 1 Region: 3-162,200-333
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 6.28e-67
Family ATP synthase (F1-ATPase), gamma subunit 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28572497|ref|NP_789277.1|
Sequence length 336
Comment ATP synthase gamma chain [Tropheryma whipplei TW08/27]
Sequence
MGAQLRVYRGKAASASVTKKITSAMELIAASRIVRAREKCGAFAPYAAALSRAVSTVLSY
SDERHPLITQIEHPRRSAILVFASDRGLAGSFNAQVMNEAVQLGDNLTERSIETDYYLIG
RKAVNFFNFRKIPFVQSWIGSSERPTFEMAQEISRTIFSCFLPARQDNKHDLGAQVVEAE
NIDMPHTPDMGDMQNNTFRRKVDEVYIVFNRFVNLVNQVPTAFRLIPMEVVDEVSSSSNI
QREHDRPVLPLYSFEPDVTSVLDELLKEYVESRVFDTLLQSATAKHAATQRAMKSASDNA
DKLIEKYTRLANNARQAEITQQISEIIGGAGALDSG
Download sequence
Identical sequences Q83G90
203267.TWT425 218496.TW343 gi|28493392|ref|NP_787553.1| gi|28572497|ref|NP_789277.1| WP_011096295.1.1961 WP_011096295.1.2273 WP_011096295.1.30872 WP_011096295.1.3524 WP_011096295.1.35576 WP_011096295.1.36967 WP_011096295.1.41189 WP_011096295.1.52318 WP_011096295.1.64596 WP_011096295.1.68459 WP_011096295.1.69741 WP_011096295.1.7325 WP_011096295.1.77801 WP_011096295.1.80906 WP_011096295.1.86550 WP_011096295.1.87151 WP_011096295.1.88484 WP_011096295.1.91097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]