SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347754656|ref|YP_004862220.1| from Candidatus Chloracidobacterium thermophilum B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347754656|ref|YP_004862220.1|
Domain Number 1 Region: 286-391
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000301
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 5-228
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.00000863
Family Dihydropteroate synthetase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|347754656|ref|YP_004862220.1|
Sequence length 402
Comment 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus Chloracidobacterium thermophilum B]
Sequence
MPVNVGGVIIGGGAPVVVQSMTNTDTADVAATVEQVAALHAAGSEIVRITVNDRDAAAAV
PDIVRGLRARGVEVPLVGDFHYNGHTLLRDFPETARLLAKYRINPGNVGFGKKHDENFKA
IVELAIQYEKPVRIGVNWGSLDQAMLARMMDENARRDPPLSAREVMLEAMCASALESAAL
AESIGLPHDRIIISTKISEVQDLVEVYRAIAARCDYPLHVGLTEAGMAMKGIVASAIGIG
LLLQEGIGDTIRVSLTPTPGGDRTEEVRVAQTILQTMGIRSFTPLVTACPGCGRTTSTLF
QEMAQDIQTYLREQMPVWKTRYPGVETLKVAVMGCIVNGPGESKHADIGISLPGTGEDPK
APVFVDGVKVTTLEGERIVPAFIDILNDYVARRFGASAGVGR
Download sequence
Identical sequences G2LFR0
gi|347754656|ref|YP_004862220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]