SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347755101|ref|YP_004862665.1| from Candidatus Chloracidobacterium thermophilum B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347755101|ref|YP_004862665.1|
Domain Number 1 Region: 90-280
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-68
Family B3/B4 domain of PheRS, PheT 0.0000105
Further Details:      
 
Domain Number 2 Region: 355-576
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.14e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00035
Further Details:      
 
Domain Number 3 Region: 584-682
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.28e-25
Family Anticodon-binding domain of PheRS 0.00066
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000157
Family Domains B1 and B5 of PheRS-beta, PheT 0.0015
Further Details:      
 
Domain Number 5 Region: 291-363
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000211
Family Domains B1 and B5 of PheRS-beta, PheT 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347755101|ref|YP_004862665.1|
Sequence length 682
Comment phenylalanyl-tRNA synthetase subunit beta, non-spirochete bacterial [Candidatus Chloracidobacterium thermophilum B]
Sequence
MKASYNWLETYVKPDLPAQELAQRFTAVGLAVDAVTPADGDFIFDFDLTTNRPDALCHFG
LAREAAVLTGTRLSFPDIHLTEQAVSGGPAVHVQIAAPDLCHRYAARLIQGVRVGPSPDW
LVRRLAAVGQRSINNIVDVTNFVLLELGHPLHAFDFERLAGRRIVVRTAQPGETLVTLDG
VQRALTPDMLMICDAERPVAVAGIMGGAESEISAVTTQVLLESAWFAPATVRRTAHRLGL
HTEASRRFERGADFENVRRALDRCAQLIVEVAGGVVVGGPVDVIARTRTPITVRLRHARI
VALTGVEVAPSRAADILTGLGFELVTEDEGESEWIVPSFRVDVSIEEDLIEEVVRHVGYD
AIPATLPGWNDAGEYLPGEERRRTLRQTLLAHGFHEAISFSWCSGEMLAATGAPGGRRIA
NPLDQQENELRTSLLPGLLTAVARNFRFGTEDVRLFEMGKVFHTVDGQLTEKEYLALALS
GRALPEDWRGQPAAESFHSLKGMLELLCDAVRCPAVTITAPAADSAVTGFLPGQVALLQI
ADQPVGRLGRISPALAAHFDFKLPVYVAELELAALLAGRTTFTAYRPLPRYPRVERDISA
LFDAALPWASIQDFIHSLAIPELEQVRLRDIFTGAQIPAGQRAITLNLWYRAADRTLTDE
EVSERHRQVVEALCTHFGATIR
Download sequence
Identical sequences G2LG36
gi|347755101|ref|YP_004862665.1| WP_014099886.1.73878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]