SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392373335|ref|YP_003205168.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392373335|ref|YP_003205168.1|
Domain Number 1 Region: 10-340
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.1e-45
Family Nitrous oxide reductase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392373335|ref|YP_003205168.1|
Sequence length 593
Comment hypothetical protein DAMO_0221 [Candidatus Methylomirabilis oxyfera]
Sequence
MSHLFPTVIFAVLALVWHPAFADAQVYVANSGSGTVSVLSTPDHALIAEIPVGALPSRIA
VTPDGAFVYVTNENSGTMSKISAASNSAVATISVGALPKGVAISADGLSVFVIADSMLKQ
FHVATDAPVRAYSLPIGVPVDVALSPDGTFAYVVDKNQNICSVYPINLTTGAVITSTECA
NGVSIGAIGGSYPVTLAIRPDGQFVYVTTPQDGAMQVVRLSDNIRVGGGCAMGPGPLGCA
LGGPNSVAVSADGGFAFTANSNNKTVSIFAIDQVSGLPAVPVRVALPTKPSYLDVTPDGT
RLYVSHGSNSVSVIDLTSNPPALTGTLTVGNGPLGVAVSPLASGGGGGGGDPQTLSVTPA
SLTFTGEQGLGDPAAQAVQVGASGMTALSWSLAATGQDPGAGSWLKADLLAGTAPPTGSV
QISAGTCGLAAGTYLGTISVASGQASNSPQSIPVSLTVAAPAGLLAAPSVRVCADRQTYQ
PGQALEIRVSLRQGVSSNSGDAYLFAGIPGDVNFVSLVWSEQGIGVNYGPAPVPFGTNFQ
VADFSGLIFERVFDASDPQGTYDLQAILAVAGSDPTIEANRLAASTINFSVTP
Download sequence
Identical sequences D5MIH3
gi|392373335|ref|YP_003205168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]