SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392374045|ref|YP_003205878.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392374045|ref|YP_003205878.1|
Domain Number 1 Region: 118-368
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 9.68e-59
Family Nitrous oxide reductase, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 38-116
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000188
Family YVTN repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392374045|ref|YP_003205878.1|
Sequence length 369
Comment hypothetical protein DAMO_0978 [Candidatus Methylomirabilis oxyfera]
Sequence
MTAVRRAVSIGVAALALLPVVREVAFAHGTGIRGTQALYVANEGSDTVSVIDLASMKVTG
AIAVGAGPQHIAVSPDRQYAVVTCSRSAEVWILALPAHTVVATVSNATGPGGQTVFGAAA
TYAYVTNSQYSRVTVIETAVGKKVAMIPVGEAPTQISISPDGGHAYVPSERSHTVAALNL
SLNVVAGELPIAVRPSAVEISPDGKYLLVASAVSNSVTVIDTTTRQSLRRIPVGDDPHHV
VFGPGGAFAYVLNRGSDSLSVIQMANHQVVATIPVGKEPSDADITPSGHYIYVTNTRGGD
VSVISTQTSAVVGTIPVGARPHNIVISGDGRYAFVANTGSDDISVINLLSQTTVGRVSVG
KRPHGIALW
Download sequence
Identical sequences D5MMT9
gi|392374045|ref|YP_003205878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]