SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392374624|ref|YP_003206457.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392374624|ref|YP_003206457.1|
Domain Number 1 Region: 12-238
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.92e-60
Family PP-loop ATPase 0.0000955
Further Details:      
 
Domain Number 2 Region: 375-459
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.53e-22
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 216-324
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000000445
Family MesJ substrate recognition domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392374624|ref|YP_003206457.1|
Sequence length 468
Comment ATPase; tRNA(Ile)-lysidine synthase [Candidatus Methylomirabilis oxyfera]
Sequence
MSDTLLHKVQGTIDRHRMLAAGEAVVLAVSGGVDSMAMLHLLLHLRTRYHGPLHVAHLNH
DLRGAESAETARFVQRQCEARQIPVTITRADGRALRDRRAGSLQAAARDLRYRFLERVAD
EQGAGRIAVGHHRDDQAETVLMNLLRGSGVRGIGGIPPVRGRIIRPLIDCSREEIERYVR
KERIPYVEDSSNHVLAYSRNRIRLELLPELAKRYNPRVIHSLANAATILEAEDTLLNDMA
DRELRAILVSRSREEFVLSIPPMTTLLSALRWRIIRRSAEELRAGHPGLTFQHTLAIDRL
LMTKGAKGAIHAPGGLRARRVGNSLVLSVRQDNERADISSVPLTVPGLTAIPASSLSLRS
ELLKEWAMGDLVVDGWTALLDADRTGMELYVRGWKEGDRFVPLGMAGRKKLQDFFTDAKV
PCDQRGSVPLVMSGGQIIWVVGFRVDERFKVTDSTQRILRVRASIQED
Download sequence
Identical sequences D5MFU5
gi|392374624|ref|YP_003206457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]