SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392374905|ref|YP_003206738.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392374905|ref|YP_003206738.1|
Domain Number 1 Region: 205-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.46e-69
Family B3/B4 domain of PheRS, PheT 0.00000398
Further Details:      
 
Domain Number 2 Region: 471-697
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.18e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00031
Further Details:      
 
Domain Number 3 Region: 39-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.08e-27
Family Myf domain 0.0045
Further Details:      
 
Domain Number 4 Region: 707-804
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.1e-26
Family Anticodon-binding domain of PheRS 0.00032
Further Details:      
 
Domain Number 5 Region: 407-479
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.97e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392374905|ref|YP_003206738.1|
Sequence length 805
Comment phenylalanyl-tRNA synthetase beta chain (Phenylalanine--tRNA ligase beta chain) [Candidatus Methylomirabilis oxyfera]
Sequence
MKVSLKWLSDYVDLVLPVQELAHRLTMCGTEVGGIEERGNGWPGIIVAQIASIEPHPAAD
SLSLVGLEIPGERIAIVSGAGNLKVGDRVPFASVGASLIDAHTGHSTVVEVVQIQGVASR
GVLCSERELGLSEAHEGVLILPDEAEVGSPLSAVLGDTILDLEVTPNRPDCLGMLGVARE
VAAITEAPLHPPDLSYREEGCDVRDEVQVEILAPDLCPRYGASVVHGVTVGPSPSWLQTR
LMAAGVRPINNVVDVTNYVMLEYGQPLHAFDYETIHGRRVVVRRATDGESLRTLDGLLRT
LSSEMLVIADANRPVALAGIMGGSETEVTPSTKSVLLESANFSPGSIRQSCRALRLRTEA
SFRFDKGLPPITTTAALRRATKLLVEICGGKAARGLWDAFPAPREPMEFTLTPAELRRVL
GIDLTTAQMRDVLAGRLGFDCREDGNALRVTPPAHRSDIQISADLVEEVARLVGYDRIPT
TTLAGRLPDYPPQPMRCLTERLSDLLVGCGLHEVITYSLIGRRLLNKMMSGRGAEMPDGY
CLANPMTPDQEMLRMSLLPSLLDCLTNNLRQDEAGPRLFEIGRVYLPHHADLPQERQMLV
IGMAGPTWPRQWSRTTAQLDFYDLKGVVEELLDRLELRETRFIQIADQQSFHPGRTTAVY
SRDVRLGVMGELHPAVARNFEVRVPVCLAEFDLEQLLSVIGERFLRIEPPPRFPAIRRDL
ALVVPERVPVADLFETVRQAGGSLLERVELFDLFRGKELPQGYKSCGVGLVFRSPDHTLI
DAEVGQVESGIIQQLQQMTGARLRG
Download sequence
Identical sequences D5MGM6
gi|392374905|ref|YP_003206738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]