SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392374947|ref|YP_003206780.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392374947|ref|YP_003206780.1|
Domain Number 1 Region: 35-98
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000432
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Weak hits

Sequence:  gi|392374947|ref|YP_003206780.1|
Domain Number - Region: 106-167
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0122
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392374947|ref|YP_003206780.1|
Sequence length 194
Comment hypothetical protein DAMO_1899 [Candidatus Methylomirabilis oxyfera]
Sequence
MRLLRLIGKGLAWAIILTAVAVVSGAITVWFATEKDKVQLPRVIGMDATAALELLREQGL
QPKVSGREYNEKIPKDAVLFQRPASGSWVQTNSEVRLVVSQGGDAVALPPLAGLPLPEAQ
QLLQRYGFTLGRVAKVHSSERPNGEVITQDPEAGAIVRRGSPVAVLLSLGPLEEPPPALT
LPSLSLREPHSTKR
Download sequence
Identical sequences D5MGR8
gi|392374947|ref|YP_003206780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]