SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392375014|ref|YP_003206847.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392375014|ref|YP_003206847.1|
Domain Number 1 Region: 905-1225
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.96e-120
Family Methionine synthase SAM-binding domain 0.0000000249
Further Details:      
 
Domain Number 2 Region: 10-402
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.31e-113
Family Homocysteine S-methyltransferase 0.0000128
Further Details:      
 
Domain Number 3 Region: 359-633
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.24e-87
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0016
Further Details:      
 
Domain Number 4 Region: 747-895
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.22e-40
Family Cobalamin (vitamin B12)-binding domain 0.00000325
Further Details:      
 
Domain Number 5 Region: 652-737
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.27e-27
Family Methionine synthase domain 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392375014|ref|YP_003206847.1|
Sequence length 1227
Comment B12-dependent homocysteine-N5-methyltetrahydrofolate transmethylase [Candidatus Methylomirabilis oxyfera]
Sequence
MTDTFGRFAELEQMLRHRIVILDGAMGTMIQMHNLTEADFRGQKFADHPCDLKGCNDLLA
ITQPAIIEAIHCQYLDAGADIIETNTFNSTSISMADYRLESLAYDLNLSGARAARSAVES
TMAKDPNHPRFVAGSIGPTNRTASMPSDIHNPAFRAVTFDRLVAAYTEQVRGLLDGGVDL
LLVETVFDTLNCKAALFAIDQYFEEVGRRVPIMVSVTIADRSGRTLSGQTVEAFWNSIAH
MPLFSVGINCAFGAKQMRPYLEELAQIASVFLSCYPNAGLPNAFGGFDETPAIMAADLGD
FAKSGWLNIVGGCCGSTPDHIRAIAKAVREYQPRVPPHPQPHTRLSGLEPVTICPEVGFV
NIGERTNIAGSAAFAKLIRSGEYEAAASIARQQVEGGAQIIDVNMDEAMLDAKAAMIQFL
NLVACEPDIARVPVMIDSSDWSVIEAGLKCAQGKPVVNSISLKEGEETFIQRARLIKRYG
AAVVVMAFDERGQADTLERKTEICARAYRILTGTVGMPPQDIIFDPNILTVATGLEEHNR
YAVDFIEATRWIKANLPYCKVSGGVSNVSFSFRGNNAVREAMHSAFLYHAVHAGLDMGIV
NAGQLTVYADITKDLLEVVEDVLLNRRPDATDRLVEFAKTMKAQERAVVKDEAWRQGSVE
ERLTHALVKGITDYIESDVEEARQRYDRPLQVIEGPLMAGMNLVGELFGSGKMFLPQVVK
TARVMKKAVAYLLPFIEVERLTSDRKRTQRKVLMATVKGDVHDIGKNIVGVVLGCNDYEV
IDLGVMAPCDTILKTAREQQVDMIGLSGLITPSLNEMMHVAREMMREGLKIPLLIGGATT
SRTHTAVKIAPLYDQPVVHVADASRAVVVAGHLSSRDQRSAFIENNRLDQERVRQAYEDR
EPRALLTLTQARDRKLLLDWRAADIPTPSSIGIRMLDEFPLDQIVPYIDWTPFFHAWEMR
GRYPEILQKPKARELFDDGQHLLEQIVRDRRLIARAVYGFFPANSVDDDIELYTDDSRSQ
VLATFHTLRQQLPKAEGQCNLALADFIAPRLPGRPDYLGAFAVTTGHGLDALCAQYEASH
DDYTSILAKALADRLAEAFAECLHRRVRAEWGYGVGEQLTNEDLIRERYRGIRPAPGYPA
CPDHSEKRTLFDLLQVERNAGIRLTDSCAMVPTSSVSGLYFAHREATYFAVGKIGRDQVL
DYAQRKRMDVRTVERWLAANLNYDVDT
Download sequence
Identical sequences D5MGY5
gi|392375014|ref|YP_003206847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]