SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392373759|ref|YP_003205592.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392373759|ref|YP_003205592.1|
Domain Number 1 Region: 177-304
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.83e-56
Family Peptidoglycan hydrolase LytM 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392373759|ref|YP_003205592.1|
Sequence length 321
Comment Peptidase, M23/M37 family [Candidatus Methylomirabilis oxyfera]
Sequence
MAKKFYTVLVLPDAGSQIRKFHIAKPLLRALAVTASLIFVAFLFLIYQTVSNTGHLLELR
QLRTTASEQGDLLQKFERLEDQMTQLREFDVRLRTAAGLEVKSAESSMVGVGGADTLSSR
ALMVAALAHQTLPAGSSTKIGVDNLGGELDRLSREMNDRNKSFQGLIGALEAKRSLLAST
PTIWPVKGWLTAGFGQRRSPFTGQRQMHEGVDISNSVGTPIIAPADGVVTYTGPLGGFGN
VVSVNHGNKISTFYAHLQQHKVSQGQRVRRGDVIGLVGTTGRVTGPHLHYEIQVNEVPVD
PTKYVIDPETVKFLGNGESAE
Download sequence
Identical sequences D5MKV4
gi|392373759|ref|YP_003205592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]