SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392374426|ref|YP_003206259.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392374426|ref|YP_003206259.1|
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.08e-94
Family Methylenetetrahydrofolate reductase 0.000000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392374426|ref|YP_003206259.1|
Sequence length 290
Comment 5,10-methylenetetrahydrofolate reductase [Candidatus Methylomirabilis oxyfera]
Sequence
MKIVDMYSTGKFGLSFEIFPPKTEAGEAQLFSALEALMVFRPSFVSCTYGAAGSTQEHTL
ELTVKIRKACGVTTVAHRTCVGSTAGGIRQWLKEATDLGIENIVALRGDPPKGQTEFKKP
EGGLAYANELVALIRQEFPHFSIAVAGYPETHQEAPSPAVDLANLKRKVNAGADAVITQL
FYDNRDFFDFRSRCVEAGITAPLIPGILPVVNLGQIQRITSMCGAKIPASFLAELETYRD
DPDGQAGAGVRFAIRQCRELLDAGIPGLHFYLLNKAEATFRILEALKLSG
Download sequence
Identical sequences D5MF95
gi|392374426|ref|YP_003206259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]