SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392375723|ref|YP_003207556.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392375723|ref|YP_003207556.1|
Domain Number 1 Region: 3-316
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.06e-114
Family UbiD middle domain-like 0.000000202
Further Details:      
 
Domain Number 2 Region: 317-480
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 6.28e-58
Family UbiD C-terminal domain-like 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392375723|ref|YP_003207556.1|
Sequence length 481
Comment hypothetical protein DAMO_2682 [Candidatus Methylomirabilis oxyfera]
Sequence
MAYEDLRGFIAALERQGLLRRITTQVDPILEVTEITDRISKRLGPALLFERVKDSSMPLL
INAFGSEAHLCLALQRASLDELAEELDGILEIKSPEGWIEKLKMLPKLTEMASYLPKRVK
DGPCKEVRITKDPSFDLLPAIKCWPMDGGRFITFPLVFTKDPDTGTRNCGMYRMQIYDER
TAGMHWHVHHGGARHYEKNRQLGRRTEVAVAIGPDPATTLSAVIPAPDGIDEMLIAGFLR
KQAVELTQCETVDLEVPANAEIVLEGYVEPNELRLEGPFGDHTGFYSLPDYYPVFHLTAI
THRRDPIYQTTIVGRPPMEDCHMGTAVERMSRPLLRKQLPEIVDFHMPFAGVFHNLVIVS
LDKAYPGHARKIMHAIWGLGQAMFSKVIVVVDKDVNVRDPAEVVWKVLNHIDPERDIEFV
MGPVETLDHASRLPKYGSKMGIDGTRKWKEEGFTREWPEEQVMDHDTKTLVDRRWKEYGL
G
Download sequence
Identical sequences D5MKD3
gi|392375723|ref|YP_003207556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]