SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339319370|ref|YP_004679065.1| from Candidatus Midichloria mitochondrii IricVA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339319370|ref|YP_004679065.1|
Domain Number 1 Region: 6-324
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.3e-104
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339319370|ref|YP_004679065.1|
Sequence length 325
Comment pyruvate dehydrogenase subunit alpha [Candidatus Midichloria mitochondrii IricVA]
Sequence
MAEKKVNISANDLHRYYEDMLLLRRFEEKAGQLYGTGLIGGFCHLYIGQEAVAIGIQAAL
KDGDSVITSYRDHGIMLATGSEPKYVMAELLGRATGRSKGKGGSMHMFDPAKGFFGGHGI
VGAQVPIGTGLAFAAKYNNTDNVCVTIFGDGAVNQGQVYESFNMAKLWDLPVIYIVENNE
YAMGTSTARGSSVTEFFKRGEPFGVPGKQVDGMSFFAVYEAMKEAVETVRKKISPLLLEI
KTYRYRGHSMSDPGRYRSKDEVTNYRENKDPIEQMKSYLLKGNLINESKLNDIEKKVKGV
VEEAVKFAQGSPEPEISELYTNIYK
Download sequence
Identical sequences F7XUN0
gi|339319370|ref|YP_004679065.1| WP_013950597.1.14442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]