SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556571426|ref|YP_008739851.1| from Actinoplanes friuliensis DSM 7358

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556571426|ref|YP_008739851.1|
Domain Number 1 Region: 12-141
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 4.84e-38
Family Molybdopterin synthase subunit MoaE 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|556571426|ref|YP_008739851.1|
Sequence length 143
Comment putative molybdopterin biosynthesis protein E [Actinoplanes friuliensis DSM 7358]
Sequence
MTTIESVRIADIRDATLSLAAHEEAVSDPRAGAVVSFQGVVRDHDGGRGVTLLEYEGHPT
AAAILREVADEIAADPDVYAVAVSHRVGVLQIGDVALVASVSTAHRAAAFAACARLVDEA
KARLPIWKRQVFADGTEEWVNCP
Download sequence
Identical sequences U5WC53
gi|556571426|ref|YP_008739851.1| WP_023563129.1.52408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]