SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383312947|ref|YP_005365748.1| from Candidatus Rickettsia amblyommii str. GAT-30V

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383312947|ref|YP_005365748.1|
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.09e-31
Family Ribosomal protein L6 0.00013
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.06e-24
Family Ribosomal protein L6 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383312947|ref|YP_005365748.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Candidatus Rickettsia amblyommii str. GAT-30V]
Sequence
MSRVGKLPITIPEGVKIGLNDLEVKISGPKGELSKTFKGNIAISLAENKLLVKPLAANKN
ARAMWGTARSIISNMVTGVKEGFKLKLEINGVGYRAMVKGKYLNLMLAKSHNTKIEIPSD
IKVEMPKQNIIILEGTDKEKLGQFASIIIKQRPPEPYKGKGIKFENQFIPRKEGKKN
Download sequence
Identical sequences A0A0F3N3Y0 A0A0F3QEZ9 H8K2S4
WP_014392626.1.13280 WP_014392626.1.32498 WP_014392626.1.34408 WP_014392626.1.61150 WP_014392626.1.64976 gi|383312947|ref|YP_005365748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]