SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16081639|ref|NP_394005.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16081639|ref|NP_394005.1|
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.83e-32
Family GHMP Kinase, N-terminal domain 0.0000666
Further Details:      
 
Domain Number 2 Region: 166-287
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 7.55e-24
Family Homoserine kinase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16081639|ref|NP_394005.1|
Sequence length 310
Comment homoserine kinase [Thermoplasma acidophilum DSM 1728]
Sequence
MPQVKVTASAPCSSANLGSGFDTLAIALDAFHDRVTISDHDGFKLTGEGIPLDPERNTAG
LAAIALLDELGLERDIEIRIEKGVPKGLGLGSSGASAAAAVKALDAYFGLGLTQEEMIGY
AMIGEIASSGSPHPDNVSASIIGGLVLVTHDDDLRASRINISGDYRFLVAIPDLFTENKT
RAARQMLPRSIPLDSYSKALGRTASLIAGLMSGNRNLIRVGMNDDIVEPSRISLFPYYYD
MKRMALANEAVAAAVSGAGPSILMVCDEMSDMDSIRAGISEIFSRYNITGRVIEARMSGG
AFVEGSPVSD
Download sequence
Identical sequences Q9HKR6
273075.Ta0530 APC6440 gi|16081639|ref|NP_394005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]