SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16082294|ref|NP_394759.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16082294|ref|NP_394759.1|
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-24
Family GHMP Kinase, N-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 185-325
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.96e-24
Family Mevalonate kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16082294|ref|NP_394759.1|
Sequence length 328
Comment hypothetical protein Ta1304 [Thermoplasma acidophilum DSM 1728]
Sequence
MYISYSPLRITFGGGGTDVEPFLSKHGGAVVNATIDRGVSVRYIEDEFQLELSSRDFVRS
YIVNMHRAASVTKMMADFLSEAGITNGRVIMSGDAPPGSGLGSSSSAVSALMNLVNSIRG
RTVDPATLAEESYNLERNHFHVVLGKQDPYAIAYGGFKYMEFGADGVKREDLGQYSEFTT
ELQRRILLVYTGKTRQSSEVLMEQVKASEMGDEKTDRNLLQMKDVARRLRDAVVKNDMDE
FAHQINRGWEIKKSLSSRITNDHIDRIIALALSNGAQAARLMGGGSQGFVLVMCKPENLN
YIQRRMMSISNFVVRTSFDMKGTRMIGH
Download sequence
Identical sequences Q9HIN2
gi|16082294|ref|NP_394759.1| 273075.Ta1304 WP_010901710.1.49201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]