SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16082515|ref|NP_393823.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16082515|ref|NP_393823.1|
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6e-32
Family GHMP Kinase, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 184-301
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.77e-24
Family Mevalonate kinase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16082515|ref|NP_393823.1|
Sequence length 323
Comment kinase related to galactokinase and mevalonate kinase [Thermoplasma acidophilum DSM 1728]
Sequence
MIITRTPLRITFVGGGTDLPDFYTRHGGSVVSAAINRYIYIIVNKKFDSKIRVSYSRTEI
VDKVDEIRHPTVREALRLLELDGGIEILSISDVPSQGTGLGSSSSFLVGLLNALHAYKSE
YVSNETLAEEAVKIEREILREAGGKQDQYMAAYGGIDLLQFFQNGEVRVKPIPLNTERLK
YLRDNTALLYTGVERSSTDIHTDQISKIDDHIQEYLEMKKLAEEFAVKLYASDIKELGEI
MDRNWMLKRKLSGKITNDLIDRLYIRAKELGAYGGKLIGAGGGGFLLFFIDHNKRENLKE
LGLRQMDYDFDFEGSRIIYYQDR
Download sequence
Identical sequences gi|16082515|ref|NP_393823.1| WP_010900772.1.49201 NYSGXRC-11277i 273075.Ta0344m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]