SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16082581|ref|NP_394474.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16082581|ref|NP_394474.1|
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily RibA-like 1.57e-57
Family RibA-like 0.00000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16082581|ref|NP_394474.1|
Sequence length 195
Comment GTP cyclohydrolase II [Thermoplasma acidophilum DSM 1728]
Sequence
MIELYSNARLPTEFGLFRIYTFVNDENKDHAVIVRGDPRGKEDVPVRIHSECLTGDVLGS
LRCDCRDQLIQSLRYLGRQDYGMLIYLRQEGRGIGLLNKIKAYSLQDSGADTVEANLKLG
LPVDSRDYSFASEVIKFFEIKSIYIMTNNPEKMKALIESGINVKGRIPIFSDPTPYDKFY
LETKKIKLGHEIENI
Download sequence
Identical sequences gi|16082581|ref|NP_394474.1| 273075.Ta1014m WP_010901425.1.49201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]