SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16082607|ref|NP_394748.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16082607|ref|NP_394748.1|
Domain Number 1 Region: 8-208
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-52
Family Ribonuclease PH domain 1-like 0.00000226
Further Details:      
 
Domain Number 2 Region: 180-257
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.52e-20
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16082607|ref|NP_394748.1|
Sequence length 260
Comment exosome complex RNA-binding protein Rrp42 [Thermoplasma acidophilum DSM 1728]
Sequence
MVKESAEILSEIRKNYILSTMKGGKRIDGRLPDEFRELTIIENYIPRANGSAYVALGNTR
VVAGVKIEAGEPFPDTPDQGVLTTNVELLPIAFPSFEAGPPNDLAIEVSRVVDRGIRESK
MISPEKLVIEQGKKVWIVFLDINVLDYDGNLIDASTIAAVAALRNAVVPASKEGGEDFKL
PVSSTPISVTMVKIGDTLVCDPSLEEDQICGGRITVTTTEDGHIRAMQKGEIGAFTVEDV
KKAVKMSLEVGKKLREKYFR
Download sequence
Identical sequences Q9HIP1
gi|16082607|ref|NP_394748.1| 355753 WP_010901699.1.49201 273075.Ta1294m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]