SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbg972.1.1300 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.1.1300
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily Smp-1-like 1.1e-43
Family Smp-1-like 0.00000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tbg972.1.1300
Sequence length 123
Comment | organism=Trypanosoma_brucei_gambiense | product=calpain-like protein fragment, putative | location=Tbg972_01:339197-339568(+) | length=123
Sequence
MGCGGSKTSTVEFINGQPTVEGDEIAKGFNEGNGLLFRIVKTRAGRWAYYNDTLDYDMHV
KVTFSEDCRIKALGQTRLEKLESGESVATVVVKPCATELFIEGHVNGYKAKMDAIPITDG
DRQ
Download sequence
Identical sequences C9ZIF5
Tbg972.1.1300 XP_011771388.1.14543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]