SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.8.1610 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.8.1610
Domain Number 1 Region: 81-233
Classification Level Classification E-value
Superfamily ApbE-like 0.00000889
Family ApbE-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tbg972.8.1610
Sequence length 710
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_08:478442-480574(+) | length=710
Sequence
MLSWNPESYVSEAVSRILAEEAKQGRGGAIPSYYDAVTSHLEAHELSKSIKVALEEQRRQ
NIGISCDIGGNVLEILFNPVDIEDAGVAEERVKKCVADIGCLFGNVSDELNSLNGKSGLV
AVSEDVLDILHHLQSMGLLTNFRFNPVSEKLGCILSATDRSSILKSMVLYNSQVEWPKGM
TLNFTDYMKAWLVDRVAARLEVLNEHRGCLIRLEDFARVFGTSRGSSVWKYGVSVSDLDG
EQKFIGCLELDALRPTAAAHAVEDPFFDHLGMQSCVACCRTTTTSYCLANALSVCSHGEK
ALFFVREWREVNGPESKDSLLSFTLYFGYGKPISDEGDVRIGENDDKRIYLHSEKDQIVR
TYKQMGDVKRYESHVETVIANSKNADLFHNISGYIGETTCENLERAMSLFPRMCVVATCI
GNENAVCVSVLKAADVLRGDATFVFCISQRSPLFNHVFAPRSQVTLNFLFDNAQAVCQAI
NDTYPLWINEIGNEPVVFESESRTYVTTKALMDISKQVAFETAESFLVGEEVLVVGRCLD
SIPSTVVINVKNTLVLQDHVPPQEFYPFLFTIVHKIYGTVGFVGYGCQLCSLSPLTMYIY
SPIESSQFALDEVYTGPKCNLTFLSSFGAPIFDGKDFEELGCGMPMAASSVSSLPQQNIY
FQVEGMLIRIVRDISDKYVICVVAANECRFNQTDPCKLLVRPDDERLIPA
Download sequence
Identical sequences C9ZUX3
Tbg972.8.1610 XP_011775488.1.14543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]