SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg.972.2.1310 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg.972.2.1310
Domain Number 1 Region: 95-124,163-252
Classification Level Classification E-value
Superfamily TPR-like 2.2e-18
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tbg.972.2.1310
Sequence length 433
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_02:258874-260175(+) | length=433
Sequence
MAAMSEEHLAFMRSMGITTEDILDPPAHVGSKSLERSGSSGPSLLDNYLDADMCKTTKAV
ILPANGSQCKKDSFLKKVFAQNDGPKEAVAKRAPPEQLKDEGNKAFEEGRYRDALLSYSN
GIDALLESDTFGLKEYKSRNVHNQPHVGYGAGAGHSSNSRRDDPKLILLAALFSNRSACY
LQAAKQIGTEEAFECALRDADRAVELRPVWFKGYSRQGDVLFKMKKYSQAVEAYAMALQF
DPGNNNLLYSLREARQRCCSKVQEDIRLSKQPGGGSPAAAPPPPPLYDTTKGNGGCGASN
VREGSMGRRAGGEQLKLNARKLWSELKHEVEASVNQPTGDNYRLEQLRLYREQKEREKNG
CSSSGSRDGLHHNHNGYDNVPRRNVSSGDTSTFCGKASSTKLRLGEIPQEFSSDAAAAYQ
QRLLEDFRRRKAR
Download sequence
Identical sequences C9ZJ44
Tbg.972.2.1310 XP_011771708.1.14543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]