SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tbg972.10.7520 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.10.7520
Domain Number 1 Region: 2500-2800
Classification Level Classification E-value
Superfamily BEACH domain 2.35e-115
Family BEACH domain 0.000000117
Further Details:      
 
Domain Number 2 Region: 2978-3231
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.96e-22
Family WD40-repeat 0.0067
Further Details:      
 
Domain Number 3 Region: 1143-1305
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000515
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 
Domain Number 4 Region: 2387-2492
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000922
Family PreBEACH PH-like domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.10.7520
Sequence length 3242
Comment | organism=Trypanosoma_brucei_gambiense | product=neurobeachin/beige protein, putative | location=Tbg972_10:1496955-1506683(-) | length=3242
Sequence
MFKFLDTFVVGRSMAPCRDTKRKDEHEAEYRVFLNHSAASEVKDELERLVSSGSKSSFPY
PLSSDTGLELSVLRLIQSNGACRQLPAKMLSLMLKRLEYACTKLGDTAKINFLRDSIPVL
EAALLVNPLKVGLLMLELGFDRHMLHILQFLRQALSDEKMGGSSVSHQVSDSAAGNVSTP
LDPSDDIPLEYSEGGGDEDVVTATRTCFDSCEPPRATEIRYRELLTILRDTLRVLKVVYV
RCGPSKRPSPGEAGVYSDMGNATGISNSQLAKGWVRLRPDSLYAEMHRRSCPAEERKGST
SGSTLRTHTKRDGILLECSRLCLHCSEVAIGSVERGGEEERTISEALCNLPLVVLSLLRN
PSELVVRNSLISIGAELTHFVAVERTGDSELQTLRQASCSMLLLSRLLRESPLLVVKAMK
SVNFSANVVRLLQVISVRYHCVHCDGCRIAGQEECARELRTLADAGNDGLHLDSGCVVSL
KRPAFNRLADNAVVDEFLHCYLGLLETQREVRRTAEVHRDLEAARHFMQIEFSLLEALLH
SGDALAPTSCLYDALMKYAINSLAPMETPVQERRQVNTAGSLVDADFYRVVFLNPVFGVF
QKDPRLQHAVLYLLHHRLNSLPPKAESSDGGAAIENEVGVILDLLCSIKVGEQSTESVEG
EAAGAGDDNEKQNRGGVVARQEELADVLLKLCVIFHSSLCGTNSDAVATAVIRCGGISKL
VGLLRECYTSGRLSGDGISMLVLHLLLRLLQRLDVQCSVLMGEVDIFFSLLSVKEIRPNA
KRMLLLLYTHSCPDAEYTQRMDQLVKCTWDALDKCARLESGCEADNEDEEMFLSVLNCMS
ASLSALRSDIFQWGSMRQLQNALCGGKENAMDAFLRLFHRTAAPWRVVDSSYGLSCIMNT
VVMLVKENPPLRAVLIHTIGADQLVESFKTAWFTSHNGSWLQFIRCMLLLVYEDDEAHVS
AAVGSVGPSCGFDNGLDGRRSVVGGEEGTLTVRNPELILPLLRLFLDLPEFKEDHRDALQ
CLVTRLSSDVMVSQSSLWMVANAGVFDSLTALIPVVAGTALIDSVLSLVMAIAGHHVTVR
ETKQFLMSIAHAKSEEERRFLVPIVIEVLSAASRHILNCQATQQNYIAFRQHNGPTGLKA
ILSDFPLDAYTLCLWIRLETHGGRRTRQCIYSLQSIEKRTILELVVKSNGQLAVSYDVEH
NKATEVDLGCQLAALVWTHLTVVHSQSKFPFSASEFVVFVNGVEVCAQPSVRYPQLQGLF
FHVGTRGEDIEQRTSSNNFVGQVAAVHFFTCALSPKSVFELFLEKSGGESVRRGFFSGIA
VYVDPRFGERGQLHNLAALLRGKPTERPLITYEGTVACNTKSIMDSVCVLGALQTVVIPL
LVLLVNPQLPFYCRVPPGRRRPASEATRKAMNELLKFVEALLLSNIVRADVLEVGLFPMI
SHAVQQFTVYDCPELPRRLYDICVALVSDEALFDAAYHSLFLSGDLLHVCSEPTQLLLLQ
VQYLLCHNNAPARRHLRGLDLPHFVVGQIIQTYNGTSEHHREMREGFFLLMEAVMEGGLT
MNDADAIQRLVSVMLRKQDLHRDVLIEILVRTRVLVANREPNLASFLGKRNFVKDLLPAL
NNSPREVRNEVVLFFILLASRSRKTQELLNPTLLASREAVHVTRDISLSWLRDKLNDCAV
DVSLYTTLLAALIGRFDVSLQQDVTITADDKICFAPVLTPLLLLMKRTPNKVMKEKVMTD
IATLVQQDSVAWRSILSVQGWYASIAELYLSDAESLEARRGEQSLFMATTAFIFSRTIFQ
ALIQESYGASELELLITYLFRRRANVFLNAVLLGVVKEYTSYLTNRRDDNTGGCLSLGSQ
LALANFTAFLSVVEDVLFYSTTAYINCDATRPADAHRKRGYSEEEELVVFTDEGMLKLEF
CEGYPEGSEYRRDEMLQNGVSFLSGDSMLLRTAPDGVWLHAALAVRTMQLLTTSGAILNS
TGTWNNSFSSSSGNGGSAPGSDAVPQGLRPRKGGFIRLFVRLFRVVCGFTLRDAAQLDDI
LSLALRWVDVVDNDYSPFALLMWQWSEVKEHSPLSSSMTLILSLHELLNRRLRFSLLGPS
LRFPDANQEILRRMKAICILHKRDLNQMQFFSRTVPSSVGEQTVKQCTLEWLCGRSGEDS
MKEFVEVASREDYEAFISQCTLAMERDQLTDKSMARTIEQYHSVTMARLHGILTDFSISR
RTMLEVLEQHLQDGTEGEGDDAAGGVESSAERFATLAVREVATVFFNTVWARFLSRCRGT
IWDVGPGEQRNMKYVRLQDVEQKLLIRRKFEFDPCGTDHANITAAGAPVSDTKVFGKQLP
RARGGEQMLLTSDSSVDCDEILDKQVSHEDTNSITGTNTAQTPKPIVHFSSSCEVPSMMH
CWSAMLIIRDCELCVFFDEENKAYNQRVADEASSLVVKPRDIIYPTGHIAQLAPGRRFRM
RRSAVEMWFRDGRSVLLNFASVKEMRTAVNRIRMSVERHKVPYHPFYLFHETPRKEPLLM
CRTNQWRERKISNFEYLLWLNFFGGRTVNDLTQYPVFPWVIADYKSDRLDLEKSSTFRDL
SLPIGICNGPQSREYVETRYEEMRQTGDVPAHYFTHYSSPAVVLYYMIRVEPFTTLQVIL
QDGHFDCADRMFHSLASCWNGVLTNSQDVRELIPELFYLPEMCVNTNGIRFGCRQDGRPT
DSLELPPWAHGDPYEFVYRMREALESDYVSLNLHHWIDLIFGYKQRGKEAIAALNVFNWH
SYEDLDRSQTDDVDERLLIDSLDNIGQTPIQLFTRPHVERRAMEYADPISCVLGMRAVDI
RHLCTRVARVVVLDNDRVLVVCGNGAALLYRISVSPVMRRMQQLPSPAVTPTLTTPRVGP
VADGNVKSHFSNQTPAPSVAAAVAHTSSYLLGIVSGAPVAPVPQGSVDGSGFRRPIVDVA
EDFERRIPPLPPGMIPNIGQKAGGPCETGNVAVLLLDNEVFVALGGVFDNTIVIRNFLTT
PAFQEERLHAHCGRVVLVAASADSRYLVSGAEDTTFIVWSCHFQRNRLKLRVDLMFTVYG
HEDDPTAVSVCPILDVVATASRDGMLMLHSLANNRLERSLRHPAKLPIDRVLIQPNCYLP
NILFTSTIDNVIHQISINGVLLRSVSAPGRITGWCTTPKQTVLVSTAPLTNTSASEDSRG
NLHFMHAFHLNVLKSVQCPLPATGDTISSCACHPSNPQAVVCGSTHGYLSLLCLGSKVDA
PP
Download sequence
Identical sequences D0A319
Tbg972.10.7520 XP_011777927.1.14543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]